Banana Milkshake
5 min
Four ingredients, one blender, done in minutes. Perfect for using up those overripe bananas sitting on the counter.
drinkdessertfor kids
All Recipes
4 recipes
Allamericanasianautumnbakedbakingbeefbreadbreakfastcakechickenchristmascomfort foodcookiescreamycrispydairy-freedessertdinnerdoughdrinkdumplingseastereasyeggfamily dinnerfermentedfinger foodfishfreezer-friendlyfrenchfriedgluten-freegreekgrilledgrillinghealthyheartyhigh-proteinindianitalianjapanesefor kidslamblightlunchlunchboxmeatmexicanmuffinsno-cooknorwegianone-potpartypastapicnicpizzapolishporkquicksaladsalmonsandwichseafoodside dishsnacksoupspicystewsugar-freesummertacotraditionalturkishveganvegetarianweeknightwinter
Mango and Strawberry Smoothie
20 min
Perfect when you skip breakfast — blend it up in two minutes and you're out the door with something actually filling.
drinkbreakfastquick
Blueberry Smoothie with Egg
5 min
Perfect for hectic mornings — ready in minutes and filling enough to actually keep you going. The egg gives it a protein boost you won't even taste.
breakfastdrinkegg
Mango Smoothie
5 min
Four ingredients, two minutes, done. Mango, banana, orange juice, and an egg make this surprisingly filling and great after a workout.
drinkbreakfastquick